Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991795
StrainMycobacterium_sp_JDM601
Protein IDYP_004524409.1
Description N-acetylglucosamine-6-phosphate deacetylase [Mycobacterium sp. JDM6
Sequence MTLISAGAVVLDGRVCRPGWLSVADGRIAECGTGPVRADVEFADCVVVPG
FIDMHCHGGGGVGYPDGPDRAAALHAAHGTTGGLASLVSAAPAVLLDQVR
ALADATRRGVVDGIHLEGPWLSGHHCGAHDPAWLRAPDDAELAALLAAGD
GAIRMVTLAPELPGGAATIRRLVDAGIVVALGHTDADYDQAQAGIDAGAT
VGTHLFNAMRALHHREPGPVPALLADPRVTVELIADGVHLHPALIRHVVA
TAGPDRVALVTDAMAAAGAGDGVFTLGGLDVEVADGVARLHGTTTIAGST
ATMDRLFATAVNLLGGHDAALAAAVRMTATTPARALGLDGAGVLAVGSAA
NLVVMDADLQLVRVMRRGMWLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo