Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991871
StrainMycobacterium_sp_JDM601
Protein IDYP_004524485.1
Description 3-hydroxyisobutyrate dehydrogenase [Mycobacterium sp. JDM601]
Sequence MIGFIGLGNMGLPMAGRLAAAGRELVVYDTRGEVINRASKFGAHAASSPQ
QVADRAEIVLASLPSLQASSAVVEAVAEAVAGGANTKLFIDLSTVGSAVA
QRNHTTLQARGVAALDAPVSGGVGGASQGSLAIMVSGPRAAFDAAEALLD
ELGRPVFVSEKPGAAQTMKLVNNLMAATTLAATAEVMVMGVKAGLDPQVM
IDVLNAGSGGTHASRDKFPKAVLPRTFDYGFATGLMVKDVRLYLDEAGAL
GLPSQLADAVAALWESTLRDQGPESDFTSIVKVLESAAGVTVGASEEVVE
Q
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo