Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991897
StrainMycobacterium_sp_JDM601
Protein IDYP_004524511.1
Description hypothetical protein JDM601_3257 [Mycobacterium sp. JDM601]
Sequence MSRRDSSQSGNTRARNRSRVVGATSAVGAFLAFGMAPLAAAPAANADVDF
DLGDIFGDLFSSWSTTDAGDAGTTWDLDALFGDPGSAAGDPFSWTGIMDQ
WFYGPIHTLTQLWITNPLGESINGMINDWSGMYLIGNGVDGTEDSPDGGD
GGLWLGDGGDGWSSDQAGVGGGDGGAALGWLGNGGDGGAGGAGAAGGDGG
AGGWWMGNGGNGGAGGAALVDGGVGGAGGDGGAAAAWFFGNGGAGGAGGA
GMDGANGGVGGALSGGAGGNGGAGGRSGYLFGDGGKGGAGGTAGDGGNAV
GDNGTNGLTGGAGGTGGSGGAGGARGSNYYAGSFYGSAGQAGDGADGGNG
GEGSDAATDGSGNYLGNGGAGGRGGDAGGGEHAGNGGNGGDAGDGNNGGQ
GGLGGRGGTALGTNVSGNGGDGGTGGLGATGTGGSGGAGGAGGNSDVGTA
GNGGNGGQGGNGATDDNTVSTRGGNGGQGGQGGSYNGTAITGTSGNGGNG
GAAGDGTLRGGNGGNGGGGGFSSGGNGGDGGDGGAAGEGLGWSDGTTTWS
IGGNGGSGGAGGSAGGPAVGGNGGAAANGADGATGTNVVSQGGNGGAGGR
GGDSSGGTTGVAADGGAGGNGTAIGGNGGSGGQGGSGYQGLSTNADGGVG
GNGGAGGNSGGVEIPAGATTPAGFGAASHAGNGGAGGSGGSSSSSAAGGD
GGDGGIGGSGAGSVDGGTGGAGGAGGNGVTAGTGGNGGAGGTAAAGDGGT
GGTGGRGGNGGPGADGLSGIPLLPGGANGDGGDGGNGNAGGLGGNGGVGG
GSTSGTGGNGGAGGAGGSGGAGGPGGPGGTNPDTGDGYDGGDGGNGAIGG
TGGNGGAHGAGGAGNGTGGAAGSGGTGGSAGAAGPGGAATGDGTPGTDGT
AGNAGADGANGTPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo