Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333991915
StrainMycobacterium_sp_JDM601
Protein IDYP_004524529.1
Description membrane-anchored serine protease (mycosin) MycP4 [Mycobacterium sp
Sequence MMRGAKVVRIARLSAAALIAGTTQYAPPASAVAPPPIDSALLPAAGPAAP
ARATVQREVCGVPTLQPDAPVTQLDGLDLPAVWALTRGAGQRVAVIDTGV
APHRRLPGLVGGGDYVSSGDGAQDCDGHGTLVAGIIGAAADPATDRFAGL
APLATVIGIRQSSAKFAAAADAPGVGDVDTLAKAVRTAADLGSSVINISA
VACLPAGSGLDDRALGAALAYAVEVRNAVVVAAAGNTDDGCGAGGPMIVT
PAWYDDYVLTVGSVDAHGAPSAFTLAGPWVDVAAPGEGVLSLSTIADAMA
NTVAGSPVHGTSFAAPVVSGLAALIRARFPDWTPRQVMDRIKATAHHPPG
GRDDVVGAGVIDPLAAVSADTTRPAAGRPVPRPAPPGTPVAPDDEPATEP
DGLRAAGTGTGVLLALLLAVVIARAAAARRRGPAAPGPG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo