Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992043
StrainMycobacterium_sp_JDM601
Protein IDYP_004524657.1
Description fatty-acid--CoA ligase [Mycobacterium sp. JDM601]
Sequence MSTDALPGILRAQAHARGSHPLLICDTERITYRDAERRSAQLAARLLALG
AGRGSHVGLLYPNGVAFLLGTLAAARIGAVVVPLPTFATAPELRRQLAHS
DVQILLAGQSYRSHDYRQRLTEALDVELDCGEPVFSGHAPQLRRVVFDAD
ADGETPEFLEALEADVDGSDPLCIIYTSGSSGAPKGVIHTHAGLLGHQRN
LNDIRRLTAADILFCNSPFFWIGGFAFALLASLLAGSTLLCSNATDPGAT
LDLIEAEKPTMTNGFVSGITALARHPSLARRDLSTLRRGNLYPLMAPDAR
PADPQLRHQMLGMTETGGPVLLSDDATDQPEHRRGSFGRPAPGFECRIRD
GELLVRGRHLMQRYHKRSREECFDADGWFATGDLVRTDADGFYYYQGRRD
ALIKTAGANVSPAEVERAIAKVTGGAVAHVVGLPDADRGQLVAAVVVAQD
ADLDLASLPELLKPELSAYKIPRRFAAIPAAELPLLTSGKVDRRRLVEVF
DA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo