Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992057
StrainMycobacterium_sp_JDM601
Protein IDYP_004524671.1
Description hypothetical protein JDM601_3417 [Mycobacterium sp. JDM601]
Sequence MADQQEQKRKRALIVFQIVIYGYLLTMFLIQLYMSFDRGWWYL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo