Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992079
StrainMycobacterium_sp_JDM601
Protein IDYP_004524693.1
Description ferredoxin [Mycobacterium sp. JDM601]
Sequence MKVTADQNICASSGQCAALAPRVFDQRDEDGVVVLLDENPPDELADAVRQ
AVAVCPSRAIKIVEE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo