Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992175
StrainMycobacterium_sp_JDM601
Protein IDYP_004524789.1
Description phosphate-transport ABC transporter ATP-binding protein PhoT [Mycob
Sequence MDLTDLNIYYGAFHAVADVTLSVAPRSVTAFIGPSGCGKSTVLRTLNRMH
EVISGARVDGSVLLDGEDIYGPSIDPVGVRKAIGMVFQRPNPFPTMSIRD
NVVAGLKLQGVRNRKLLDETAEHSLRGANLWNEVKDRLDRPGGGLSGGQQ
QRLCIARAIAVQPDVLLMDEPCSALDPISTMAIEELIAQLKQDYTIVIVT
HNMQQAARVSDQTAFFNLEAVGKPGRLIEIDGTEKVFSNPSCKETEDYIS
GRFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo