Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992225
StrainMycobacterium_sp_JDM601
Protein IDYP_004524839.1
Description K+ transport system NAD-binding component [Mycobacterium sp. JDM601
Sequence MPNSLHLLAFWTRRPNKPRPKPIRVPTTVETTEVIFLFMRRMRAPFIVVI
AMFSVCTTGLMLMPGVDAQGNPYRLTVFDAFYQMTITLTTVGYSEVPHAF
SYPQRMWLSMSIYLVVISWAFAIGVFFSVINDTAFQDAIAAQRFRRQVRR
MVEPFVIIAGYGQAGRAVGAELDEHGRRFVVIDKQESRVASVTSGQLSSD
VPAIEGDCASPPVLGVAGLAHRDCEGVLALTNDDDANLAVVMTVALLRPE
VPVFTRCSDPKIQARIERFAPAGIINPADRFGDYLALSIHRPVNHQLLRW
LMDNEEDQLPPLRRGLATGRWVVCADPEFGDELVRDLTASGLAVDLVDPA
EDELDVADAVGFIAGTNSDTTNIAVAEQARLANADVYLVVRQQTNAKKAL
LDALQIDSVYIAPELVAREVLARTLTPVFWSFVEHAFGRDEAWATRVRDH
LQETCGRRTPSRDVIVLSAEQAPAIADWLRRGETLTLGDLIRRPDDREVR
LPLAALVLMRDGAPTFMPDPDTTLALDDQVLLVGKPEGLSQVREVCNYPA
TVEYLATGRDVPLTWVWARLTARMRRRADAARPH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo