Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992301
StrainMycobacterium_sp_JDM601
Protein IDYP_004524915.1
Description lipid transfer protein or keto acyl-CoA thiolase Ltp4 [Mycobacteriu
Sequence MSTRDVAVVGFAHAPHVRRTDGTTNGVEMLMPCFEQLYRELGIERADIGF
WCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDGAWALYEAYIKVL
TGEVDTALAYGFGKSSAGQLRRILALQTDPYTVAPLWPDSISIAGLQARL
GLDGGQWTQEQMARVALESFAVAERVDSVESSDSLDELLERPFFADPLRR
HDIAPITDGAAAIVLAAGDKARELCENPAWITGFEHRIDSPVLGSRDLTR
SPSTTASARAASGDDMPAVEVAEIHAPFTHQHLILTEAMRLPSRAKVNPS
GGALAANPMFVAGLERIGFAAQHIFNGSAGRVLAHATSGPALQQNLVAVM
EGRN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo