Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992321
StrainMycobacterium_sp_JDM601
Protein IDYP_004524935.1
Description 2-keto-4-pentenoate hydratase [Mycobacterium sp. JDM601]
Sequence MLSAQIRDELAAELAQAERSRVPISPLTAAHPDIDVVDAYEIQLINIRQR
IAEGARVVGHKVGLSSEAMQQMMGVDEPDYGHLLNEMQVFEDTPVKASNY
LYPRVEVEVAFILGADLPGADCTEEHVLAATEAFAPAIELIDSRITDWKI
KLCDTIADNASSAGFVLGKQRVKPGDIDIKGIDASLTKNGEVVAKGRSDA
VLGNPVTAVAWLARKVESFGVRLKAGDIVLPGTATRAIDVHPGDDCVADF
SGLGSVRLVFE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo