Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992401
StrainMycobacterium_sp_JDM601
Protein IDYP_004525015.1
Description acetyl-/propionyl-CoA carboxylase subunit beta AccD [Mycobacterium
Sequence MAALLAEVDGLHGKVAEGGSAASVQRHRERGKLPVRERLSLLADRHGFIM
ELSPLAGWGTTDPLGGGLVTAVTEIHGRAVMVIANDPTVRGGSLSPTSIA
RTLRAMDIAETNRLPVVTLVESGGADLEKQADIFVPGGEQFRRLTELSAA
GIPTVSVVFGSSTAGGAYLPGMSDYTIFVKDRGYAFLGGPPLVKMAIDED
VTEHELGGADMHARVSGLADYLAADEPDALRQARSVIFRFGLADPVPGGP
APVHDPDELLGIVPEDPKTPFDIREVIGRIVDGSQFDEFKPLYGPNLVTG
WAELSGMPIGVLANNGILFSPESQKGAQFIELCNQIGTPILFIQNITGFM
VGSAAEKGGIIKDGAKLINAVSNSQVPHVTLMVGVSYGAGNYAMAGRAYR
PRLVLTWPTHRIAVMGGRQLAGVMSIVRKRSAQSRNIEFDHTADETQRAE
DEARIEAESTALYATGRVWDDGIIDPRHSRAALTVAFGISRDTPRPGSRQ
RAGFGIFRF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo