Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992525
StrainMycobacterium_sp_JDM601
Protein IDYP_004525139.1
Description ATP-dependent protease ATP-binding subunit ClpC1 [Mycobacterium sp.
Sequence MLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQ
QAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAA
QVLVKLGADLTRVRQQVIQLLSGYQGKETAEAGTGGRGGESGSPSTSLVL
DQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVG
KTAVVEGLAQAIVAGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKK
VLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIG
ATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHR
VSISDSAIVAAATLADRYINDRFLPDKAIDLIDEAGARMRIRRMTAPPDL
REFDEKIADARREKESAIDAQDFEKAASLRDREKQLVAQRAEREKQWRAG
DLDVVAEVDDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEDELHKRIIGQ
KDAVNAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALAEFLF
GDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSV
VLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNCVLIFTSNLGTS
DISKAVGLGFTQGGGENNYERMKLKVNDELKKHFRPEFLNRIDDIIVFHQ
LSKEEIIQMVDLMIGRVAKQLKAKDMDIALSDKAKSLLAKRGFDPVLGAR
PLRRTIQREIEDQLSEKILFEELGPGQLVTVDVDNWDGEGPQEDAVFTFV
GSQKPAAEESDLAKAGAPTAD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)14
Vaccine TargetNo