Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID333992631
StrainMycobacterium_sp_JDM601
Protein IDYP_004525245.1
Description aspartate kinase [Mycobacterium sp. JDM601]
Sequence MALVVQKYGGSSVADADRVRSVAERIVETKNDGDDVVVVCSAMGDTTDDL
LDLAQQVSSAPPARELDMLLTAGERISNALVAMAVEELGCQARSFTGSQA
GVITTGVHGKAKIIDVTPGRLQAALGENQVVLVAGFQGVSQDTKDVTTLG
RGGSDTTAVALAAALNADVCEIYTDVDGIYSSDPRIVPNAKKLDTVTFEE
MLELAACGAKVLMLRCVEYARRYHLPIHVRSSYTDKPGTIVTGSIKDIPM
EDALLTGVAHDKSEAKVTVVGIPDLPGYAAKIFRAVADADINIDMVLQNV
SKLEDGKTDITFTCPRDNGPAAVAKLESLKTEIGFTEVLYDTNVGKVSLV
GAGMRSHPGVTATFCETLADNGINIDLISTSEIRISVLVAEDDLDKAVVA
LHQAFDLGGDEEATVYAGTGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo