Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630290
StrainM_africanum_GM041182
Protein IDYP_004721932.1
Description phosphoenolpyruvate carboxykinase [Mycobacterium africanum GM041182
Sequence MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCD
QLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTN
NWMDPGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSE
YVVVSMRTMTRMGKAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSE
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTD
DGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTA
AAEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLD
LDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)48
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)414
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)233
Prediction of IL4 inducing peptides (IL4pred)433