Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630328
StrainM_africanum_GM041182
Protein IDYP_004721970.1
Description heat shock protein Hsp [Mycobacterium africanum GM041182]
Sequence MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKD
GDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKD
GRTLREIRYGSFRRSFRLPAHVTSEAIAASYAAGVLTVRVAGAYKAPAET
QAQRIAITK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)104
CTL epitope prediction (CTLpred)24
Prediction of interferon-gamma inducing peptides (IFNepitope)76
Prediction of IL4 inducing peptides (IL4pred)131