Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630518
StrainM_africanum_GM041182
Protein IDYP_004722160.1
Description transporter [Mycobacterium africanum GM041182]
Sequence MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVFVPSLE
AVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDA
AHKYYDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLA
GNQGTPLANESVEAVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSM
ARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVLGHSG
AIGLTTFAVSLLTSLAIAAGTDYGIFIIGRYQEARQAGEDKEAAYYTMYR
GTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGMLVAVAVALTLG
PAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVGL
LALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHD
MRNPADFLVLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQN
AGQLQTIKYQRDRANDMLKQADEMATTIAVLTRMHSLMAEMASTTHRMVG
DTEEMKEITEELRDHVADFDDFWRPIRSYFYWEKHCYGIPICWSFRSIFD
ALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPPQIEAMENMRTMILTM
HSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNKDFQRAM
KSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAK
IYLAGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIV
GTVALSLGASFGLSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLV
SRFKQEIGAGLKTGIIRSMGGTGKVVTNAGLVFAVTMASMAVSDLRVIGQ
VGTTIGLGLLFDTLIVRSFMTPSIAALLGRWFWWPLRVRSRPARTPTVPS
ETQPAGRPLAMSSDRLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)76
MHC class II prediction (Propred)212
MHC class 1 prediction (Propred1)694
CTL epitope prediction (CTLpred)178
Prediction of interferon-gamma inducing peptides (IFNepitope)376
Prediction of IL4 inducing peptides (IL4pred)638