Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339630996
StrainM_africanum_GM041182
Protein IDYP_004722638.1
Description phosphate ABC transporter substrate-binding protein [Mycobacterium
Sequence MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSP
VTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTV
NIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVL
AAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLS
KQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGI
SFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLD
QAHFQPLPPAVVKLSDALIATISS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)59
MHC class II prediction (Propred)46
MHC class 1 prediction (Propred1)232
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)112
Prediction of IL4 inducing peptides (IL4pred)221