Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631841
StrainM_africanum_GM041182
Protein IDYP_004723483.1
Description PPE family protein [Mycobacterium africanum GM041182]
Sequence MDFGALPPEINSGRMYCGPGSGPMLAAAAAWDGVAVELGLAATGYASVIA
ELTGAPWVGAASLSMVAAATPYVAWLSQAAARAEQAGMQAAAAAAAYEAA
FVMTVPPPVITANRVLVMTLIATNFFGQNSAAIAVAEAQYAEMWAQDAVA
MYGYAAASASASRLIPFAAPPKTTNSAGVVAQVAAVAAMPGLLQRLSSAA
SVSWSNPNDWWLVRLLGSITPTERTTIVRLLGQSYFATGMAQFFASIAQQ
LTFGPGGTTAGSGGAWYPTPQFAGLGASRAVSASLARANKIGALSVPPSW
VKTTALTESPVAHAVSANPTVGSSHGPHGLLRGLPLGSRITRRSGAFAHR
YGFRHSVVARPPSAG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)50
MHC class 1 prediction (Propred1)263
CTL epitope prediction (CTLpred)61
Prediction of interferon-gamma inducing peptides (IFNepitope)163
Prediction of IL4 inducing peptides (IL4pred)186