Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631864
StrainM_africanum_GM041182
Protein IDYP_004723506.1
Description ATPase P [Mycobacterium africanum GM041182]
Sequence MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFV
LYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSA
AVGVLAVSGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNAVEDEGLQPYQ
VRVICRPKAETYVRAHIVQRTSSNDITLRGIRTGPAGDDNITLTAHLLMV
GHTPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)54
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)43
Prediction of interferon-gamma inducing peptides (IFNepitope)120
Prediction of IL4 inducing peptides (IL4pred)125