Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631874
StrainM_africanum_GM041182
Protein IDYP_004723516.1
Description preprotein translocase subunit SecA [Mycobacterium africanum GM0411
Sequence MNVHGCPRIAACRCTDTHPRGRPAFAYRWFVPKTTRAQPGRLSSRFWRLL
GASTEKNRSRSLADVTASAEYDKEAADLSDEKLRKAAGLLNLDDLAESAD
IPQFLAIAREAAERRTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGA
IAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLDAMGLTVGWITADSTP
DERRTAYDRDVTYASVNEIGFDVLRDQLVTDVNDLVSPNPDVALIDEADS
VLVDEALVPLVLAGTTHRETPRLEIIRLVAELVGDKDADEYFATDSDNRN
VHLTEHGARKVEKALGGIDLYSEEHVGTTLTEVNVALHAHVLLQRDVHYI
VRDDAVHLINASRGRIAQLQRWPDGLQAAVEAKEGIETTETGEVLDTITV
QALINRYATVCGMTGTALAAGEQLRQFYQLGVSPIPPNKPNIREDEADRV
YITTAAKNDGIVEHITEVHQRGQPVLVGTRDVAESEELHERLVRRGVPAV
VLNAKNDAEEARVIAEAGKYGAVTVSTQMAGRGTDIRLGGSDEADHDRVA
ELGGLHVVGTGRHHTERLDNQLRGRAGRQGDPGSSVFFSSWEDDVVAANL
DHNKLPMATDENGRIVSPRTGSLLDHAQRVAEGRLLDVHANTWRYNQLIA
QQRAIIVERRNTLLRTVTAREELAELAPKRYEELSDKVSEERLETICRQI
MLYHLDRGWADHLAYLADIRESIHLRALGRQNPLDEFHRMAVDAFASLAA
DAIEAAQQTFETANVLDHEPGLDLSKLARPTSTWTYMVNDNPLSDDTLSA
LSLPGVFR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)76
MHC class II prediction (Propred)97
MHC class 1 prediction (Propred1)555
CTL epitope prediction (CTLpred)144
Prediction of interferon-gamma inducing peptides (IFNepitope)325
Prediction of IL4 inducing peptides (IL4pred)519