Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339631925
StrainM_africanum_GM041182
Protein IDYP_004723567.1
Description L-lactate dehydrogenase [Mycobacterium africanum GM041182]
Sequence MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPR
AAFDYADGAAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPT
VLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIA
VPQGRKWFQLYMWRDRDRSMALVRRAAAAGFDTMLVTVDVPVAGARLRDV
RNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYL
NTVFDPSVTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGAR
CTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRH
VTQLRRLGPIGAPT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)34
MHC class II prediction (Propred)72
MHC class 1 prediction (Propred1)297
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)173
Prediction of IL4 inducing peptides (IL4pred)220