Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 339632071 |
| Strain | M_africanum_GM041182 |
| Protein ID | YP_004723713.1 |
| Description | heat shock protein HspX [Mycobacterium africanum GM041182] |
| Sequence | MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR TVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 28 |
| MHC class II prediction (Propred) | 14 |
| MHC class 1 prediction (Propred1) | 98 |
| CTL epitope prediction (CTLpred) | 18 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 71 |
| Prediction of IL4 inducing peptides (IL4pred) | 53 |