Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339632072
StrainM_africanum_GM041182
Protein IDYP_004723714.1
Description hypothetical protein MAF_20470 [Mycobacterium africanum GM041182]
Sequence MPDTMVTTDVIKSAVQLACRAPSLHNSQPWRWIAEDHTVALFLDKDRVLY
ATDHSGREALLGCGAVLDHFRVAMAAAGTTANVERFPNPNDPLHLASIDF
SPADFVTEGHRLRADAILLRRTDRLPFAEPPDWDLVESQLRTTVTADTVR
IDVIADDMRPELAAASKLTESLRLYDSSCHAELFWWTGAFETSEGIPHSS
LVSAAESDRVTFGRDFPVVANTDRRPEFGHDRSKVLVLSTYDNERASLLR
CGEMLSAVLLDATMAGLATCTLTHITELHASRDLVAALIGQPATPQALVR
VGLAPEMEEPPPATPRRPIDEVFHVRAKDHR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)36
MHC class II prediction (Propred)41
MHC class 1 prediction (Propred1)222
CTL epitope prediction (CTLpred)44
Prediction of interferon-gamma inducing peptides (IFNepitope)135
Prediction of IL4 inducing peptides (IL4pred)257