Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339632312
StrainM_africanum_GM041182
Protein IDYP_004723954.1
Description hypothetical protein MAF_22980 [Mycobacterium africanum GM041182]
Sequence MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATV
MVEGHTHTISGAVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLS
DSTPPDVNGFGISLKIGSVDYQMPYQPVQSPTQVEATRQGKSYTLTGTGH
AVIPGQTGMRELPFGVHVTCP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)10
MHC class 1 prediction (Propred1)101
CTL epitope prediction (CTLpred)15
Prediction of interferon-gamma inducing peptides (IFNepitope)73
Prediction of IL4 inducing peptides (IL4pred)111