Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339632374
StrainM_africanum_GM041182
Protein IDYP_004724016.1
Description phospholipase C [Mycobacterium africanum GM041182]
Sequence MSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLTDIEHIVLCL
QENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRIN
TTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQARTRSVANTPVV
MGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWISATVNPDGD
QGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLLGGLNDTSLS
RNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLPQVSWVVPLT
VESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDEHGGFFDHV
TPLTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCFVISPYSRG
GLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTSAFNFAAPPD
PSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQTTPVQESGPA
RPIPSGIC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)136
MHC class II prediction (Propred)126
MHC class 1 prediction (Propred1)637
CTL epitope prediction (CTLpred)132
Prediction of interferon-gamma inducing peptides (IFNepitope)345
Prediction of IL4 inducing peptides (IL4pred)705