Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID339632715
StrainM_africanum_GM041182
Protein IDYP_004724357.1
Description RNA polymerase sigma factor SigA [Mycobacterium africanum GM041182]
Sequence MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRA
TKPAARSVKPASAPQDTTTSTIPKRKTRAAAKSAAAKAPSARGHATKPRA
PKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLED
DVAPDADDDLDSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASG
DFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELA
KRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGGRAKNHLLEANL
RLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWW
IRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDA
VSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTR
ERIRQIESKTMSKLRHPSRSQVLRDYLD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)46
MHC class II prediction (Propred)53
MHC class 1 prediction (Propred1)343
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)196
Prediction of IL4 inducing peptides (IL4pred)287