Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 339633867 |
| Strain | M_africanum_GM041182 |
| Protein ID | YP_004725509.1 |
| Description | 10 KDA culture filtrate antigen EsxB [Mycobacterium africanum GM041 |
| Sequence | MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA AQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 12 |
| MHC class II prediction (Propred) | 27 |
| MHC class 1 prediction (Propred1) | 166 |
| CTL epitope prediction (CTLpred) | 18 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 90 |
| Prediction of IL4 inducing peptides (IL4pred) | 202 |