Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340625189
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004743641.1
Description phosphotyrosine protein phosphatase PTPB [Mycobacterium canettii CI
Sequence MAVRELPGAWNFRDVADTATALQPGRLFRSSELSRLDDAGRATLRRLGIT
DVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDEADDSAPHETAFKR
LLTNDGSNGEYGESSQSINDAATRYMTDEYRQFPTRSGAQRALHRVVTLL
AAGRPVLTHCFAGKDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLR
ARISEMIQQRSDTELAPEVVTFTKARLSDGVLGVRAEYLAAARQTIDETY
GSLGGYLRDAGISQATVNRMRGVLLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)18
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)196
CTL epitope prediction (CTLpred)44
Prediction of interferon-gamma inducing peptides (IFNepitope)118
Prediction of IL4 inducing peptides (IL4pred)132