Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340625910
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004744362.1
Description outer membrane protein [Mycobacterium canettii CIPT 140010059]
Sequence MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAF
ERPQSVTGPTGVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDE
AAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPD
FGLKVERDTVTLTGTAPSSEHKDAVKRAATSTWPDMKIVDNIEVTGQAPP
GPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKAC
PDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL
GSVNPIASNATPEGRAKNRRVEIVVN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)39
MHC class 1 prediction (Propred1)209
CTL epitope prediction (CTLpred)40
Prediction of interferon-gamma inducing peptides (IFNepitope)111
Prediction of IL4 inducing peptides (IL4pred)214