Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340626305
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004744757.1
Description hypothetical protein MCAN_13061 [Mycobacterium canettii CIPT 140010
Sequence MLQRSLEVNGRKLAMSARSAKRERKNASTATSKCYVVPPSARGWVHAYSV
TATSMLNRRKAILDYLQGAVWVLPTFGVAIGLGSGAVLSMIPVKSGTLID
KLMFQGTPGDARGVLIVVSATMITTIGIVFSLTVLSLQIASSQFSVRLLR
TFLRDVPNQVVLAIFACTFAYSTGGLHTVGEHRDGGAFIPKVAVTGSLAL
AFVSIAALIYFLHHLMHSIQIDTIMDKVRLRTLGLVDQLYPESDTADRQV
ETPPSPPADAVPLLAPHSGYLQTVDVDDIAELAAASRYTALLVTFVGDYV
TAGGLLGWCWRRGTAPGAPGSDFPQRCLRHVHIGFERTLQQDIRFGLRQM
VDIALRALSPALNDPYTAIQVVHHLSAVESVLASRALPDDVRRDRAGELL
FWLPYPSFATYLHVGCAQIRRYGSREPLVLTALLQLLSAVAQNCVDPSRR
VAVQTQIALVVRAAQREFADESDRAMVLGAAARATEVVERPGTLAPPPST
FGQVAAAQAAASTIRSADRDG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)35
MHC class II prediction (Propred)104
MHC class 1 prediction (Propred1)369
CTL epitope prediction (CTLpred)98
Prediction of interferon-gamma inducing peptides (IFNepitope)213
Prediction of IL4 inducing peptides (IL4pred)328