Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340627466
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004745918.1
Description hypothetical protein MCAN_24911 [Mycobacterium canettii CIPT 140010
Sequence MAFRDILVLFSMKTLLTLAMAAASSTALTTVGVSGARLITYCVGVEDI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)0
MHC class II prediction (Propred)13
MHC class 1 prediction (Propred1)33
CTL epitope prediction (CTLpred)7
Prediction of interferon-gamma inducing peptides (IFNepitope)18
Prediction of IL4 inducing peptides (IL4pred)14