Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340628127
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004746579.1
Description putative NADH dehydrogenase I subunit G NuoG [Mycobacterium canetti
Sequence MTQAADTDIRVGQPEMVTLTIDGVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEAKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAAQGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYAIAPFATGGLHKMSGRLIKTVPGAE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWMPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHVAELPAAA
GRDADGILAAAADETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALHGSTLQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPDTAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)65
MHC class II prediction (Propred)85
MHC class 1 prediction (Propred1)543
CTL epitope prediction (CTLpred)118
Prediction of interferon-gamma inducing peptides (IFNepitope)359
Prediction of IL4 inducing peptides (IL4pred)552