Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340628792
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004747244.1
Description putative integral membrane transport protein MMPL8 [Mycobacterium c
Sequence MCDALTQPVRTPRPSTNLRAEPHRPTGDGGVFPRLGRLIVRRPWVVIAFW
VALAGLLAPTVPSLDEISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQS
VAVVVLSDAKGLGAADERSYKELVDALRRDTRDVVMLQDFVTTPPLRELM
TSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQVAGSTLTANLTGP
AATVADLNLTGQRDRSRIEFAITILLLVILLIIYRNPITMVLPLITIGMS
VAVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR
QGADSDQAVKKALTSIGKVIAASAATVAITFLAMVFTQLGILKTVGPMLG
ISVAVVFFAAVTLLPALMVLAGRRGWIAPRRDLTRRFWRSSGVHIVRRPK
THLLASALVLVILAGCAGLVRYNYDDRKTLPASVESSIGYAALDKHFPSN
LIIPEYLFIQSSTDLRTPKALADLEQMAQRVSQVPGVAMVRGITRPAGRS
LEQARTSWQAGEVGSKLDEGSKQIAAHTGDIDKLAGGANLMASKLGDVRA
QVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID
ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGT
LAKISELARQLQATRAVQTLAATVSGLRRALATVIRAMGSLGMSSPGGVR
SKINLVNKGVNDLADGSRQLAEGVQLLVDQVKKMGFGLGEASAFLLAMKD
TATTPAMAGFYIPPELLSYATGESVKAETMPSEYRDLLGGLNVDQLKKVA
AAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNTALADAK
VSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVVLILIVLLRAIVAPLYLI
GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLI
SRLREEAVLGVRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQ
GAFVLGTGLLLDTFLVRTVTVPAIAVLVGQANWWLPSSWRPATWWPLGRR
RGRAQRTKRKPLLPKEEEEQSPPDDDDLIGLWLHDGLRL
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)75
MHC class II prediction (Propred)218
MHC class 1 prediction (Propred1)780
CTL epitope prediction (CTLpred)195
Prediction of interferon-gamma inducing peptides (IFNepitope)427
Prediction of IL4 inducing peptides (IL4pred)640