Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383305938
StrainMtb_RGTB327
Protein IDYP_005358749.1
Description DNA gyrase subunit B [Mycobacterium tuberculosis RGTB327]
Sequence MAAQKKKAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVV
DNAVDEAMAGYATTVNVVLLEDGGVEVADDGRGIPVATHASGIPTVDVVM
TQLHAGGKFDSDAYAISGGLHGVGVSVVNALSTRLEVEIKRDGYEWSQVY
EKSEPLGLKQGAPTKKTGSTVRFWADPAVFETTEYDFETVARRLQEMAFL
NKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTAPHKVKSRT
FHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSES
VHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDI
REGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANP
TDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDP
RKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNT
EVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFR
FMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKK
INKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSI
LMGEDVDARRSFITRNAKDVRFLDV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)6
Vaccine TargetNo