Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306058
StrainMtb_RGTB327
Protein IDYP_005358869.1
Description serine protease [Mycobacterium tuberculosis RGTB327]
Sequence MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPL
DPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGA
TDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVG
EPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFD
AAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIA
GQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGIST
GDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLA
EGPPA
B cell epitope (IEDB)2
T cell epitope (IEDB)20
MHC binder (IEDB)3
Vaccine TargetNo