Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306066
StrainMtb_RGTB327
Protein IDYP_005358877.1
Description putative ACETYLtransferase [Mycobacterium tuberculosis RGTB327]
Sequence MTPQARPARRADVRELSRTMARAFYDDPVMSWLLSNDNARTARLTRLFAT
IVRHQHLAGGGVEVARGAAGIGGAALWDPPDRWRESRRQQLAMTPGFLRV
FGFRTAKARAALDVMMRVHPEEPHWYLAAIGSDPTVRGQGFGQVLMRSRL
DRCDAEHCPAYLESTKPENVPYYQRFGFRVTREIALPDAGPPLWAMWREP
R
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)5
Vaccine TargetNo