Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306070
StrainMtb_RGTB327
Protein IDYP_005358881.1
Description methionine sulfoxide reductase A [Mycobacterium tuberculosis RGTB32
Sequence MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTH
AEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFD
EQQKRIALDTIADVEASGLWPGKVVTEVQARPGISGKPNPSTRTTCSATP
TGTRATSSGPAGGYPDGPPNLHCGPAFHPNSGPERGPELAVSVGASPPDR
HPSG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo