Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306078
StrainMtb_RGTB327
Protein IDYP_005358889.1
Description hypothetical protein MRGA327_00930 [Mycobacterium tuberculosis RGTB
Sequence MRTHDDTWDIKTSVGATAVMVAAARAVETDRPDPLIRDPYARLLVTNAGA
GAIWEAMLDPTLVAKAAAIDAETAAIVAYLRSYQAVRTNFFDTYFASAVA
AGIRQVVILASGLDSRAYRLDWPAGTIVYEIDQPKVLSYKSTTLAENGVT
PSAGRREVPADLRQDWPAALRDAGFDPTARTAWLAEGLLMYLPAEAQDRL
FTQVGAVSVAGSRIAAETAPVHGEERRAEMRARFKKVADVLGIEQTIDVQ
ELVYHDQDRASVADWLTDHGWRARSQRAPDEMRRVGRWVEGVPMADDPTA
FAEFVTAERL
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetNo