Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306082
StrainMtb_RGTB327
Protein IDYP_005358893.1
Description quinone oxidoreductase [Mycobacterium tuberculosis RGTB327]
Sequence MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGE
YQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVP
VANVVRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGG
VGTAAVQIAKAMQAGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVR
DHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAAGAVPTLKVNR
LLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLS
EAQAALQSLDDGGVLGKVVLEP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo