Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306108
StrainMtb_RGTB327
Protein IDYP_005358919.1
Description MCE-family protein mce1C [Mycobacterium tuberculosis RGTB327]
Sequence MGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILGRKVLEIEPRG
AQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSET
VDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQV
DRLLVNAKTLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLE
QLRILTDLLVDRKEDLAETLTILGRFSASFGETFASGPYFKVLLANLVPG
QILQPFVDAAFKKRGISPEDFWRSAGLPAYRWPDPNGTRFPNGAPPPPPP
VLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPLPCANLTQGPFGGPDF
PAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQEAPPGA
RTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSE
N
B cell epitope (IEDB)2
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetNo