Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306142
StrainMtb_RGTB327
Protein IDYP_005358953.1
Description hypothetical protein MRGA327_01320- partial [Mycobacterium tubercul
Sequence MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPGVGCRT
VARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATR
RPVVAVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVR
GARRS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo