Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306148
StrainMtb_RGTB327
Protein IDYP_005358959.1
Description long-chain-fatty-acid--CoA ligase [Mycobacterium tuberculosis RGTB3
Sequence MENNEHVHAVMWAARRSGLYYVPINTHLTASEAAYIVDNSGAKAIVGSAA
LRETCHGLAEHLPGGLPDLLMLAGGGLVGWMTYPECVADQPDTPIEDERE
GDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALLDFWMDADSVYLSP
APMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQFVPA
MFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEY
YASSEASGSTLITAEDWLTHPGSVGKPIQGGVHIVGARRQRAAAEPAGRN
LFRGRVPLRIPQRSGENRGVAQQARLGNRRRRRLSRRRRLLVPDRPAPPH
DHLRRREHLPAGGGEPLGRPPQGARRGGVRRSRRRDGSTCHGRGANRRLR
RCQRSVRRRAISLVTRPLVTLQVSKVDRVRTAIAAHRHRKALQERAGRKI
LGVTDAAGGPTCPPRHRLYPAPGHQLSGYHVALDLVGAFTAVPRRTRSSS
RSRRGYARRLGRFPSRPRRRTTWPSRPPYRSVGRCRTARRHSGSADGPL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo