Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306156
StrainMtb_RGTB327
Protein IDYP_005358967.1
Description enoyl-CoA hydratase [Mycobacterium tuberculosis RGTB327]
Sequence MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQ
LDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTK
PLIAAVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLR
LPERIPYAIAMELALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEK
ITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFTSNDAKEGAIA
FAERRRPRWTGT
B cell epitope (IEDB)0
T cell epitope (IEDB)3
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)30
MHC class II prediction (Propred)33
MHC class 1 prediction (Propred1)172
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)107
Prediction of IL4 inducing peptides (IL4pred)139