Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306250
StrainMtb_RGTB327
Protein IDYP_005359061.1
Description deoxycytidine triphosphate deaminase [Mycobacterium tuberculosis RG
Sequence MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTH
IDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFSGHITLELIQRRQPADHFVARHENRSAV
HVAPDQPVRASLRQFPGGVEIPGSARAHAVALLPELHQVYLASGAARPVA
GSCHLPFAWCSAPRCGSLIAATYTQWCAMQRLRHWVSGCHPRRRYGATGT
RGRRGRYRSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo