Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306256
StrainMtb_RGTB327
Protein IDYP_005359067.1
Description hypothetical protein MRGA327_02090 [Mycobacterium tuberculosis RGTB
Sequence MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELLAPGPG
ERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLI
SLYHGDGVTLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLV
LTSISDDQPLAARFDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPAT
VWFTATAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo