Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306328
StrainMtb_RGTB327
Protein IDYP_005359139.1
Description acetate kinase A/propionate kinase 2 [Mycobacterium tuberculosis RG
Sequence MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVADHAQAL
HRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEEL
SALAPLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDR
DVADRWHIRRYGFHGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASAS
AIARGRPVETSMGLTPLEGLVMGTRSGDLDPGVISYLWRTARMGVEDIES
MLNHRSGMLGLAGERDFRRLRLVIETGDRSAQLAYEVFIHRLRKYLGAYL
AVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQDRNLGPGHGAR
RISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo