Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306354
StrainMtb_RGTB327
Protein IDYP_005359165.1
Description short chain dehydrogenase [Mycobacterium tuberculosis RGTB327]
Sequence MTANDNKTRKWSAADVPDQSGRVVVVTGANTGIGYHTAAVFADRGAHVVL
AVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPR
IDVLINNAGVMWTPKQVTKDGFELQFGTNHLGHFALTGLVLDHMLPVPGS
RVVTVSSQGHRIHAAIHFDDLQWERRYNRVAAYGQAKLANLLFTYELQRR
LGEAGKSTIAVAAHPGGSNTELTRNLPRLIRPVATVLGPLLFQSPEMGAL
PTLRAATDPTTQGGQYYGPDGFGEQRGHPKVVQSSAQSHDKDLQRRLWTV
SEELTGVSFGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo