Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306482
StrainMtb_RGTB327
Protein IDYP_005359293.1
Description poly-gamma-glutamate synthesis protein [Mycobacterium tuberculosis
Sequence MAGNPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGYVRLAE
RVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKP
VCYRMHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQS
VGAGADLLAARRSALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVW
LIRDPAQRDVADDVAAQVLADKRPGDIAIVSMHWGSNWGYATAPGDVAFA
HRLIDAGIDMVHGHSSHHPRPIEIYRGKPILYGCGDVVDDYEGIGGHESF
RSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQTDTEWLRNTIE
RISRRFGIRVVTRPDNLLEVVPAANLTSKE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo