Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306490
StrainMtb_RGTB327
Protein IDYP_005359301.1
Description hypothetical protein MRGA327_03680 [Mycobacterium tuberculosis RGTB
Sequence MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHVNTLIG
TGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMT
HASVGCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFP
GTGVIAELTATTRTGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIED
NTTITGSATSGGFCGKKNLYTVYFAMKFSQPFSSYGTWDGYAVYPGSHSM
NSSYSGGYVGFPAGSVLEVRTALSYVSVDGARANLDAEGGASFDDIRAAT
SSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFNDVDGRYIGFDG
VIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQS
GAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAAT
QGGVGLDGFLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDF
AISRFADSLGDTATAAVFQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPG
FVAYPSGFGQDGYDEGNAEQYLWWVPHNVAGLVTALGGRTAVVKRLDRFT
KKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKTQRTVDRVRGLFGPTP
GGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAVIALPTG
KSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLA
GTPNKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQR
MIDGVDDYTVTPTSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGY
YPIYVTTSAGDSARTLIVLVVVAEAVE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)8
Vaccine TargetNo